PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do010118.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family Dof
Protein Properties Length: 432aa    MW: 46164.8 Da    PI: 8.1991
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do010118.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.48.8e-40101161262
      zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                 ++k+l+cprC+s++tkfCyynny+++qPr+fCk+C+ryWt+GGa+rnvPvG+grrk+k++s
  Do010118.1 101 PDKILPCPRCNSMDTKFCYYNNYNINQPRHFCKNCQRYWTAGGAMRNVPVGAGRRKSKSAS 161
                 7899*****************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-2797150IPR003851Zinc finger, Dof-type
PfamPF027012.8E-32103159IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.929105159IPR003851Zinc finger, Dof-type
PROSITE patternPS013610107143IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 432 aa     Download sequence    Send to blast
MAACRVGGGG GDCLIKLFGK TIPVPEAAAA ASVAEADNKD IQQSDSSTTE LKGQENTLQD  60
STGSPPQQEV ADTEDSSAAK NSSGDQQQGE TANQKEKLKK PDKILPCPRC NSMDTKFCYY  120
NNYNINQPRH FCKNCQRYWT AGGAMRNVPV GAGRRKSKSA SAASHFLQRV RAALPIDPLC  180
TAAKTNGTVL SFGSDMSLDL TEQMKHLKEK LVPITRIKSS DDRSVGSCTE GSAKGEDSNQ  240
MNQKEKVIAD KSANVAQHPC MNGVTMWPFS CAPPLASYTS GIAIPFYPAA AAYWGCMVPG  300
AWNTAPWQPH SQSESASSLS TASPASTKSN CFTPGKRPRD SDEGDTMPTG KVWVPKTIRI  360
DDADEVARSS ILSLIGINGD KAGKDRRGCK LASVFEQKEE AKTATHAVIN SLPFLQGNPA  420
ALSRSLTFQE GS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004985552.10.0PREDICTED: cyclic dof factor 1-like
TrEMBLK4AAA50.0K4AAA5_SETIT; Uncharacterized protein
STRINGSi035812m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20993793
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.22e-53cycling DOF factor 2